Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCORL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | LCORL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19161820
|
Novus Biologicals
NBP19161820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP191618
|
Novus Biologicals
NBP191618 |
100 μL |
Each for $487.50
|
|
|||||
Description
LCORL Polyclonal specifically detects LCORL in Human, Bovine samples. It is validated for Western Blot.Specifications
| LCORL | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ30696, LCoR-like protein, ligand dependent nuclear receptor corepressor-like, ligand-dependent nuclear receptor corepressor-like protein, MLR1MBLK1-related protein, transcription factor MLR1 | |
| LCORL | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_742165 | |
| 254251 | |
| Synthetic peptide directed towards the C terminal of human A830039H10RIK. Peptide sequence EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title