Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Obox6 Antibody, Novus Biologicals™

Obox6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19161920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19161920 20 μL
NBP191619 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19161920 Supplier Novus Biologicals Supplier No. NBP19161920UL

Description

Rabbit Polyclonal Antibody

Obox6 Polyclonal specifically detects Obox6 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Obox6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_663756
Gene Alias oocyte specific homeobox 6
Gene Symbols OBOX6
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of mouse OBOX6. Peptide sequence MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 252830
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.