Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ces2a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$517.59
Specifications
| Antigen | Ces2a |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191620
![]() |
Novus Biologicals
NBP191620 |
100 μL |
Each for $517.59
|
|
|||||
NBP19162020
![]() |
Novus Biologicals
NBP19162020UL |
20 μL | N/A | N/A | N/A | ||||
Description
Ces2a Polyclonal specifically detects Ces2a in Mouse samples. It is validated for Western Blot.Specifications
| Ces2a | |
| Polyclonal | |
| Purified | |
| RUO | |
| carboxylesterase 2A | |
| CES6 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_598721 | |
| 102022 | |
| Synthetic peptide directed towards the middle region of human CES6. Peptide sequence MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL. | |
| Primary | |
| 61 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title