Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ces2a Antibody, Novus Biologicals™

Ces2a Antibody, Novus Biologicals™
SDP

Catalog No. NBP19162020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19162020 20 μL
NBP191620 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19162020 Supplier Novus Biologicals Supplier No. NBP19162020UL

Description

Rabbit Polyclonal Antibody

Ces2a Polyclonal specifically detects Ces2a in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Ces2a
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_598721
Gene Alias carboxylesterase 2A
Gene Symbols CES6
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human CES6. Peptide sequence MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL.
Molecular Weight of Antigen 61 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 102022
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.