Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SEP15 Antibody, Novus Biologicals™

SEP15 Antibody, Novus Biologicals™
SDP

Catalog No. NBP191629 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191629 100 μL
NBP19162920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP191629 Supplier Novus Biologicals Supplier No. NBP191629
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

44454 Polyclonal specifically detects 44454 in Human samples. It is validated for Western Blot.

Specifications

Antigen SEP15
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O60613
Gene Alias 15 kDa selenoprotein
Gene Symbols 43358
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human SEP15The immunogen for this antibody is SEP15 (NP_004252). Peptide Sequence: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9403
Test Specificity Expected identity based on immunogen sequence: Pig: 100%; Canine: 100%; Human: 100%; Zebrafish: 100%; Rat: 100%; Mouse: 100%; Bovine: 92%; Rainbow trout: 85%.
Reconstitution Centrifuge before reconstitution. Reconstitute in 50μL distilled water to a final antibody concentration 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.