Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RBM3 Antibody, Novus Biologicals™

RBM3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP182420UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP182420UL 20 μL
NBP182411 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP182420UL Supplier Novus Biologicals Supplier No. NBP18241120UL

Description

Rabbit Polyclonal Antibody

RBM3 Polyclonal specifically detects RBM3 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen RBM3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_058089
Gene Alias IS1-RNPL, putative RNA-binding protein 3, RNA binding motif (RNP1, RRM) protein 3, RNA binding motif protein 3, RNA-binding motif protein 3, RNPL
Gene Symbols RBM3
Host Species Rabbit
Immunogen Synthetic peptide towards Rbm3. Peptide sequence LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNP.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5935
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.