Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SIK1/Snf1lk Antibody, Novus Biologicals™

SIK1/Snf1lk Antibody, Novus Biologicals™
SDP

Catalog No. NBP18241720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18241720 20 μL
NBP182417 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18241720 Supplier Novus Biologicals Supplier No. NBP18241720UL

Description

Rabbit Polyclonal Antibody

SIK1/Snf1lk Polyclonal specifically detects SIK1/Snf1lk in Rat samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen SIK1/Snf1lk
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_067725
Gene Alias EC 2.7.11, EC 2.7.11.1, msk, myocardial SNF1-like kinase, salt-inducible kinase 1, Salt-inducible protein kinase 1, serine/threonine protein kinase, serine/threonine-protein kinase SIK1, Serine/threonine-protein kinase SNF1-like kinase 1, Serine/threonine-protein kinase SNF1LK, SIK, SIK-1, SNF1-like kinase, SNF1LKMSK
Gene Symbols SIK1
Host Species Rabbit
Immunogen Synthetic peptide towards Snf1lk. Peptide sequence TPVLQSQAGLGATVLPPVSFQEGRRASDTSLTQGLKAFRQQLRKNARTKG.
Molecular Weight of Antigen 85 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 150094
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.