DRGX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191316

Catalog No. NBP191316

Description

DRGX Polyclonal specifically detects DRGX in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DRGX
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dorsal root ganglia homeobox, DRG11, paired related homeobox-like 1, paired-like homeodomain trancription factor DRG11, paired-related homeobox protein-like 1, PRRXL1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 644168
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001073989
• Gene Symbols: DRGX
• Immunogen: Synthetic peptide directed towards the N terminal of human DRGX. Peptide sequence MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Zebrafish: 100%; Bovine: 92%; Chicken: 92%; Canine: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG