Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DRGX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DRGX |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DRGX Polyclonal specifically detects DRGX in Human samples. It is validated for Western Blot.Specifications
DRGX | |
Polyclonal | |
Rabbit | |
NP_001073989 | |
644168 | |
Synthetic peptide directed towards the N terminal of human DRGX. Peptide sequence MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
dorsal root ganglia homeobox, DRG11, paired related homeobox-like 1, paired-like homeodomain trancription factor DRG11, paired-related homeobox protein-like 1, PRRXL1 | |
DRGX | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title