YL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182385

Catalog No. NBP182385

Description

YL1 Polyclonal specifically detects YL1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: YL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Protein YL-1, Swc2, TCFL1, Transcription factor-like 1, transcription factor-like 1 (YL-1), vacuolar protein sorting 72 (yeast), vacuolar protein sorting 72 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 72 homolog, YL-1, YL1CFL1
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_033362
• Gene Symbols: VPS72
• Immunogen: Synthetic peptide towards YL1. Peptide sequence AGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6944
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG