Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RIP5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP19133220UL

View more versions of this product

Catalog No. NBP19133220

$206.00 / Each of 1

Qty

Add to Cart

Description

RIP5 Polyclonal specifically detects RIP5 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RIP5
Classification	Polyclonal
Dilution	Western Blot 1:1000
Gene Accession No.	NP_061328
Gene Symbols	C20orf24
Immunogen	Synthetic peptide directed towards the N terminal of human C20orf24. Peptide sequence MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	C20orf24, chromosome 20 open reading frame 24, PNAS-11
Host Species	Rabbit
Purification Method	Protein A purified
Regulatory Status	RUO
Gene ID (Entrez)	55969
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

RIP5 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions