Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UGT1A7 Antibody, Novus Biologicals™

UGT1A7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19133520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19133520 20 μL
NBP191335 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19133520 Supplier Novus Biologicals Supplier No. NBP19133520UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

UGT1A7 Polyclonal specifically detects UGT1A7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen UGT1A7
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_061950
Gene Alias GNT1, polypeptide A7, UDP glucuronosyltransferase 1 family, polypeptide A7, UDP-glucuronosyltransferase 1-7, UDP-glucuronosyltransferase 1-G, UDPGT 1-7, UGT1, UGT1-07, UGT1G
Gene Symbols UGT1A7
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human UGT1A7. Peptide sequence VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54577
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.