Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UGT1A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | UGT1A5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191336
![]() |
Novus Biologicals
NBP191336 |
100 μL |
Each for $480.74
|
|
|||||
NBP19133620
![]() |
Novus Biologicals
NBP19133620UL |
20 μL | N/A | N/A | N/A | ||||
Description
UGT1A5 Polyclonal specifically detects UGT1A5 in Human samples. It is validated for Western Blot.Specifications
| UGT1A5 | |
| Polyclonal | |
| Rabbit | |
| NP_061951 | |
| 54579 | |
| Synthetic peptide directed towards the N terminal of human UGT1A5. Peptide sequence EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| GNT1, polypeptide A5, UDP glucuronosyltransferase 1 family, polypeptide A5, UDP-glucuronosyltransferase 1-E, UDPGT 1-5, UGT1, UGT1*5, UGT1E, UGT-1E | |
| UGT1A5 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title