Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TXNDC16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | TXNDC16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19133920
![]() |
Novus Biologicals
NBP19133920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191339
![]() |
Novus Biologicals
NBP191339 |
100 μL |
Each for $487.50
|
|
|||||
Description
TXNDC16 Polyclonal specifically detects TXNDC16 in Human samples. It is validated for Western Blot.Specifications
TXNDC16 | |
Polyclonal | |
Rabbit | |
NP_065835 | |
57544 | |
Synthetic peptide directed towards the N terminal of human TXNDC16. Peptide sequence EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1344, thioredoxin domain containing 16, thioredoxin domain-containing protein 16 | |
TXNDC16 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title