Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FEZF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19136720UL
Description
FEZF1 Polyclonal specifically detects FEZF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FEZF1 | |
Polyclonal | |
Western Blot 1:1000, Immunohistochemistry | |
NP_001019784 | |
FEZF1 | |
Synthetic peptide directed towards the C terminal of human FEZF1. Peptide sequence CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FEZ, FEZ family zinc finger 1, zinc finger protein 312B, ZNF312B | |
Rabbit | |
Affinity Purified | |
RUO | |
389549 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction