Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM132D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | TMEM132D |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19136620
![]() |
Novus Biologicals
NBP19136620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191366
![]() |
Novus Biologicals
NBP191366 |
100 μL |
Each for $487.50
|
|
|||||
Description
TMEM132D Polyclonal specifically detects TMEM132D in Mouse samples. It is validated for Western Blot.Specifications
TMEM132D | |
Polyclonal | |
Rabbit | |
NP_766473 | |
121256 | |
The specific Immunogen is proprietary information. Peptide sequence QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HBE120, KIAA1944, mature OL transmembrane protein, mature oligodendrocytes transmembrane protein, MGC138770, MGC138771, MOLT, transmembrane protein 132D | |
TMEM132D | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title