Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM132D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | TMEM132D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191366
|
Novus Biologicals
NBP191366 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP19136620
|
Novus Biologicals
NBP19136620UL |
20 μL | N/A | N/A | N/A | ||||
Description
TMEM132D Polyclonal specifically detects TMEM132D in Mouse samples. It is validated for Western Blot.Specifications
| TMEM132D | |
| Polyclonal | |
| Rabbit | |
| NP_766473 | |
| 121256 | |
| The specific Immunogen is proprietary information. Peptide sequence QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HBE120, KIAA1944, mature OL transmembrane protein, mature oligodendrocytes transmembrane protein, MGC138770, MGC138771, MOLT, transmembrane protein 132D | |
| TMEM132D | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title