Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM132D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19136620UL
Description
TMEM132D Polyclonal specifically detects TMEM132D in Mouse samples. It is validated for Western Blot.Specifications
TMEM132D | |
Polyclonal | |
Western Blot 1:1000 | |
NP_766473 | |
TMEM132D | |
The specific Immunogen is proprietary information. Peptide sequence QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK. | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HBE120, KIAA1944, mature OL transmembrane protein, mature oligodendrocytes transmembrane protein, MGC138770, MGC138771, MOLT, transmembrane protein 132D | |
Rabbit | |
Affinity Purified | |
RUO | |
121256 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction