Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBTD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
Antigen | MBTD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19137520
![]() |
Novus Biologicals
NBP19137520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191375
![]() |
Novus Biologicals
NBP191375 |
100 μL |
Each for $501.50
|
|
|||||
Description
MBTD1 Polyclonal specifically detects MBTD1 in Mouse samples. It is validated for Western Blot.Specifications
MBTD1 | |
Polyclonal | |
Rabbit | |
NP_598773 | |
54799 | |
The specific Immunogen is proprietary information. Peptide sequence LVPPRTVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
mbt domain containing 1 | |
MBTD1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title