NLRP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213661

Catalog No. NBP213661

Description

NLRP7 Polyclonal specifically detects NLRP7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NLRP7
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CLR19.4, MGC126471, NACHT, leucine rich repeat and PYD containing 7, NACHT, LRR and PYD containing protein 7, NACHT, LRR and PYD domains-containing protein 7, NALP7MGC126470, NLR family, pyrin domain containing 7, NOD12HYDM, Nucleotide-binding oligomerization domain protein 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 7, PAN7, PYPAF3FLJ94610, PYRIN-containing APAF1-like protein 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 199713
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NLRP7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only