Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NLRP7 Antibody, Novus Biologicals™

NLRP7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP213661 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP213661 0.1 mL
NB404995 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP213661 Supplier Novus Biologicals Supplier No. NBP213661
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

NLRP7 Polyclonal specifically detects NLRP7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen NLRP7
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CLR19.4, MGC126471, NACHT, leucine rich repeat and PYD containing 7, NACHT, LRR and PYD containing protein 7, NACHT, LRR and PYD domains-containing protein 7, NALP7MGC126470, NLR family, pyrin domain containing 7, NOD12HYDM, Nucleotide-binding oligomerization domain protein 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 7, PAN7, PYPAF3FLJ94610, PYRIN-containing APAF1-like protein 3
Gene Symbols NLRP7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAK
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 199713
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.