NLRP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB404995	Novus Biologicals NBP21366125UL	25ul
NBP213661	Novus Biologicals NBP213661	0.1 mL

Description

NLRP7 Polyclonal specifically detects NLRP7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NLRP7
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 199713
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CLR19.4, MGC126471, NACHT, leucine rich repeat and PYD containing 7, NACHT, LRR and PYD containing protein 7, NACHT, LRR and PYD domains-containing protein 7, NALP7MGC126470, NLR family, pyrin domain containing 7, NOD12HYDM, Nucleotide-binding oligomerization domain protein 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 7, PAN7, PYPAF3FLJ94610, PYRIN-containing APAF1-like protein 3
• Gene Symbols: NLRP7
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only