NOB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155404

Catalog No. NBP155404

Description

NOB1 Polyclonal specifically detects NOB1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NOB1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: adenocarcinoma antigen recognized by T lymphocytes 4, ART4, ART-4, MST158, nin one binding protein, NIN1/RPN12 binding protein 1 homolog (S. cerevisiae), NOB1PPSMD8BP1, Phosphorylation regulatory protein HP-10, Protein ART-4, PSMD8 binding protein 1, RNA-binding protein NOB1
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 28987
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9ULX3
• Gene Symbols: NOB1
• Immunogen: Synthetic peptides corresponding to NOB1(NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOB1. Peptide sequence TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Yeast: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG