NOC2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25687125UL

Catalog No. NB394263

Description

NOC2L Polyclonal specifically detects NOC2L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NOC2L
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DKFZP564°C186, FLJ35172, NET15, NET7, NIR, NOC2-like protein, novel INHAT (inhibitor of histone acetyltransferase) repressor, nucleolar complex associated 2 homolog (S. cerevisiae), nucleolar complex protein 2 homolog, Protein NOC2 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26155
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NOC2L
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only