NOC4L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180464

Catalog No. NBP180464

Description

NOC4L Polyclonal specifically detects NOC4L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NOC4L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC3162, NET49, NOC4, NOC4 protein homolog, NOC4-like protein, nucleolar complex associated 4 homolog (S. cerevisiae), nucleolar complex protein 4 homolog, Nucleolar complex-associated protein 4-like protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79050
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_076983
• Gene Symbols: NOC4L
• Immunogen: Synthetic peptide directed towards the C terminal of human NOC4L. Peptide sequence CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Equine: 92%; Pig: 92%; Mouse: 78%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig
• Isotype: IgG