NOC4L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18046420UL

Catalog No. NBP18046420

Description

NOC4L Polyclonal specifically detects NOC4L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NOC4L
• Classification: Polyclonal
• Dilution: Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_076983
• Gene Symbols: NOC4L
• Immunogen: Synthetic peptide directed towards the C terminal of human NOC4L. Peptide sequence CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: MGC3162, NET49, NOC4, NOC4 protein homolog, NOC4-like protein, nucleolar complex associated 4 homolog (S. cerevisiae), nucleolar complex protein 4 homolog, Nucleolar complex-associated protein 4-like protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79050
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.