Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NOC4L Antibody, Novus Biologicals™

NOC4L Antibody, Novus Biologicals™
SDP

Catalog No. NBP18046420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18046420 20 μL
NBP180464 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18046420 Supplier Novus Biologicals Supplier No. NBP18046420UL

Description

Rabbit Polyclonal Antibody

NOC4L Polyclonal specifically detects NOC4L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen NOC4L
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_076983
Gene Alias MGC3162, NET49, NOC4, NOC4 protein homolog, NOC4-like protein, nucleolar complex associated 4 homolog (S. cerevisiae), nucleolar complex protein 4 homolog, Nucleolar complex-associated protein 4-like protein
Gene Symbols NOC4L
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human NOC4L. Peptide sequence CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79050
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.