NOD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258617

Catalog No. NBP258617

Description

NOD2 Polyclonal specifically detects NOD2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NOD2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: BLAU, CARD15caspase recruitment domain protein 15, caspase recruitment domain family, member 15, Caspase recruitment domain-containing protein 15, CDACUG, CLR16.3, IBD1NLR family, CARD domain containing 2, Inflammatory bowel disease protein 1, NLRC2, NOD-like receptor C2, nucleotide-binding oligomerization domain 2, nucleotide-binding oligomerization domain containing 2, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 2, nucleotide-binding oligomerization domain-containing protein 2, PSORAS1NOD2B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NOD2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIP
• Quantity: 100 μL
• Research Discipline: Apoptosis, Autophagy, Cancer, Caspases, Cell Biology
• Gene ID (Entrez): 64127
• Target Species: Human
• Isotype: IgG

For Research Use Only