Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOLC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | NOLC1 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NOLC1 Polyclonal specifically detects NOLC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
NOLC1 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
140 kDa nucleolar phosphoprotein, HCV NS5A trans-regulated protein 13, HCV NS5A-transactivated protein 13, Hepatitis C virus NS5A-transactivated protein 13, KIAA0035NS5ATP13, NOPP130, NOPP140, Nucleolar 130 kDa protein, nucleolar and coiled-body phosphoprotein 1, nucleolar and coiled-body phosphprotein 1, Nucleolar phosphoprotein p130, nucleolar protein p130, P130 | |
NOLC1 | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q14978 | |
9221 | |
This antibody was developed against a recombinant protein corresponding to amino acids: VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title