Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOMO1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$159.00 - $487.50
Specifications
| Antigen | NOMO1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17956620
|
Novus Biologicals
NBP17956620UL |
20 μL |
Each for $159.00
|
|
|||||
|
NBP179566
|
Novus Biologicals
NBP179566 |
100 μL |
Each for $487.50
|
|
|||||
Description
NOMO1 Polyclonal specifically detects NOMO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NOMO1 | |
| Unconjugated | |
| RUO | |
| NODAL modulator 1, Nomo, NOMO3, pM5 protein 3, pM5 protein, telomeric copy | |
| NOMO1 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| NP_055102 | |
| 23420 | |
| Synthetic peptide directed towards the C terminal of human NOMO1The immunogen for this antibody is NOMO1. Peptide sequence QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title