Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NOMO1 Antibody, Novus Biologicals™

NOMO1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17956620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17956620 20 μL
NBP179566 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17956620 Supplier Novus Biologicals Supplier No. NBP17956620UL

Description

Rabbit Polyclonal Antibody

NOMO1 Polyclonal specifically detects NOMO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen NOMO1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_055102
Gene Alias NODAL modulator 1, Nomo, NOMO3, pM5 protein 3, pM5 protein, telomeric copy
Gene Symbols NOMO1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human NOMO1The immunogen for this antibody is NOMO1. Peptide sequence QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23420
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.