Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOMO1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17956620UL
Description
NOMO1 Polyclonal specifically detects NOMO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NOMO1 | |
| Polyclonal | |
| Western Blot 1:1000, Immunohistochemistry | |
| NP_055102 | |
| NOMO1 | |
| Synthetic peptide directed towards the C terminal of human NOMO1The immunogen for this antibody is NOMO1. Peptide sequence QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| NODAL modulator 1, Nomo, NOMO3, pM5 protein 3, pM5 protein, telomeric copy | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 23420 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction