Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOMO1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | NOMO1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17956620
|
Novus Biologicals
NBP17956620UL |
20 μL |
Each for $152.22
|
|
NBP179566
|
Novus Biologicals
NBP179566 |
100 μL |
Each for $436.00
|
|
Description
NOMO1 Polyclonal specifically detects NOMO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NOMO1 | |
| Unconjugated | |
| RUO | |
| NP_055102 | |
| 23420 | |
| Synthetic peptide directed towards the C terminal of human NOMO1The immunogen for this antibody is NOMO1. Peptide sequence QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| NODAL modulator 1, Nomo, NOMO3, pM5 protein 3, pM5 protein, telomeric copy | |
| NOMO1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title