non-muscle heavy chain 10 Myosin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238566

Catalog No. NBP238566

Description

non-muscle heavy chain 10 Myosin Polyclonal specifically detects non-muscle heavy chain 10 Myosin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: non-muscle heavy chain 10 Myosin
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P35580
• Gene Symbols: MYH10
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4628
• Target Species: Human
• Isotype: IgG