Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NOP10 Antibody, Novus Biologicals™

NOP10 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1563820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1563820 20 μL
NBP156381 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1563820 Supplier Novus Biologicals Supplier No. NBP15638120UL

Description

Rabbit Polyclonal Antibody

NOP10 Polyclonal specifically detects NOP10 in Human samples. It is validated for Western Blot.

Specifications

Antigen NOP10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NPE3
Gene Alias H/ACA ribonucleoprotein complex subunit 3, homolog of yeast Nop10p, MGC70651, NOLA3Nucleolar protein family A member 3, NOP10 ribonucleoprotein homolog (yeast), NOP10P, Nucleolar protein 10, nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs), snoRNP protein NOP10
Gene Symbols NOP10
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NOLA3 The peptide sequence was selected from the middle region of NOLA3. Peptide sequence MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 55505
Test Specificity This product is specific to Subunit or Isoform: 3.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.