Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOP10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | NOP10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156381
|
Novus Biologicals
NBP156381 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP1563820
|
Novus Biologicals
NBP15638120UL |
20 μL | Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area. | N/A | |||||
Description
NOP10 Polyclonal specifically detects NOP10 in Human samples. It is validated for Western Blot.Specifications
| NOP10 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| H/ACA ribonucleoprotein complex subunit 3, homolog of yeast Nop10p, MGC70651, NOLA3Nucleolar protein family A member 3, NOP10 ribonucleoprotein homolog (yeast), NOP10P, Nucleolar protein 10, nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs), snoRNP protein NOP10 | |
| NOP10 | |
| IgG | |
| This product is specific to Subunit or Isoform: 3. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NPE3 | |
| 55505 | |
| Synthetic peptides corresponding to NOLA3 The peptide sequence was selected from the middle region of NOLA3. Peptide sequence MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title