Notch-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257913

Catalog No. NBP257913

Description

Notch-1 Polyclonal specifically detects Notch-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Notch-1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 2.1.2.11, EC 3.4.21.68, hN1, Notch (Drosophila) homolog 1 (translocation-associated), notch 1Notch homolog 1, translocation-associated (Drosophila), Notch homolog 1, translocation-associated, TAN1neurogenic locus notch homolog protein 1, Translocation-associated notch protein TAN-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NOTCH1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer Stem Cells, Golgi Apparatus Markers, Growth and Development, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway
• Gene ID (Entrez): 4851
• Target Species: Human
• Isotype: IgG

For Research Use Only