Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Notch-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Notch-1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Notch-1 Polyclonal specifically detects Notch-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Notch-1 | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer Stem Cells, Golgi Apparatus Markers, Growth and Development, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway | |
EC 2.1.2.11, EC 3.4.21.68, hN1, Notch (Drosophila) homolog 1 (translocation-associated), notch 1Notch homolog 1, translocation-associated (Drosophila), Notch homolog 1, translocation-associated, TAN1neurogenic locus notch homolog protein 1, Translocation-associated notch protein TAN-1 | |
NOTCH1 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
4851 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title