Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Centrin 3 Protein
Shop All R&D Systems Products

Click to view available options
Quantity:
0.1 mg
0.5 mg
Description
A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-167 of Human Centrin 3 The Recombinant Human Centrin 3 Protein is derived from E. coli. The Recombinant Human Centrin 3 Protein has been validated for the following applications: SDS-Page.
Specifications
Specifications
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA, SDS-PAGE |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 0.1M NaCl |
| Molecular Weight (g/mol) | 21.7kDa |
| Purification Method | Protein |
| Quantity | 0.1 mg |
| Source | Human |
| Immunogen | Human recombinant CETN3,1-167 aa. MGSSHHHHHHSSGLVPRGSHMSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Regulatory Status | RUO |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction