Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ NANP Protein
Highly purified. Generating reliable and reproducible results.
$398.00 - $1110.00
Specifications
Concentration | 0.5mg/mL |
---|---|
For Use With (Application) | ELISA, SDS-PAGE |
Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl |
Gene ID (Entrez) | 140838 |
Molecular Weight (g/mol) | 31.9kDa |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1493085
|
Novus Biologicals™
NBP1493080.5MG |
0.5mg |
Each for $1,110.00
|
|
|||||
NBP14930801
|
Novus Biologicals™
NBP1493080.1MG |
0.1mg |
Each for $398.00
|
|
|||||
Description
A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-248 of Human NANP The Recombinant Human NANP Protein is derived from E. coli. The Recombinant Human NANP Protein has been validated for the following applications: SDS-Page.Specifications
0.5mg/mL | |
Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl | |
31.9kDa | |
Human | |
Store at -80°C. Avoid freeze-thaw cycles. | |
NANP | |
>90% |
ELISA, SDS-PAGE | |
140838 | |
Protein | |
NANP, 1-248aa. Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST | |
RUO | |
Unconjugated |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title