NOXRED1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170434

Catalog No. NBP170434

Description

NOXRED1 Polyclonal specifically detects NOXRED1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NOXRED1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: NOXRED1
• Immunogen: Synthetic peptides corresponding to NOXRED1 The peptide sequence was selected from the middle region of NOXRED1. Peptide sequence KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 122945
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C14orf148, NADP-dependent oxidoreductase domain containing 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig 77%, Porcine 77%, Bovine 85%, Mouse 85%.
• Target Species: Human, Mouse, Bovine, Canine, Guinea Pig
• Isotype: IgG