Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NPAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25692225UL
Description
NPAT Polyclonal specifically detects NPAT in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
NPAT | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
CAND3, E14, E14/NPAT, Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus, Nuclear Protein Of The ATM Locus, Nuclear Protein, Ataxia-Telangiectasia Locus, Nuclear Protein, Coactivator Of Histone Transcription, Nuclear Protein, Co-Activator Of Histone Transcription, p220, Protein NPAT | |
Rabbit | |
Affinity Purified | |
RUO | |
4863 | |
Human | |
Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
NPAT | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction