NR4A3/NOR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155295

Catalog No. NBP155295

Description

NR4A3/NOR1 Polyclonal antibody specifically detects NR4A3/NOR1 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: NR4A3/NOR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CHN, CSMF, MINOR, NOR1, TEC
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92570
• Gene Symbols: NR4A3
• Immunogen: Synthetic peptides corresponding to NR4A3(nuclear receptor subfamily 4, group A, member 3) The peptide sequence was selected from the middle region of NR4A3 (AAB02581). Peptide sequence KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8013
• Target Species: Human, Rat, Rat, Pig, Bovine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only