Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NRBP2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15496920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15496920 20 μL
NBP154969 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15496920 Supplier Novus Biologicals Supplier No. NBP15496920UL

Rabbit Polyclonal Antibody

NRBP2 Polyclonal specifically detects NRBP2 in Human samples. It is validated for Western Blot.

Specifications

Antigen NRBP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NSY0
Gene Alias DKFZp434P086, MGC138699, nuclear receptor binding protein 2, nuclear receptor-binding protein 2, pp9320, Transformation-related gene 16 protein, transformation-related protein 16, TRG16, TRG-16
Gene Symbols NRBP2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NRBP2(nuclear receptor binding protein 2) The peptide sequence was selected from the middle region of NRBP2. Peptide sequence VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 340371
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.