NRIP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25811225UL

Catalog No. NB393615

Description

NRIP3 Polyclonal specifically detects NRIP3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NRIP3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C11orf14, chromosome 11 open reading frame 14, nuclear receptor interacting protein 3, nuclear receptor-interacting protein 3, NY-SAR-105, Sarcoma antigen NY-SAR-105
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NRIP3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQT
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 56675
• Target Species: Human
• Isotype: IgG

For Research Use Only