Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NRK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$482.50
Specifications
| Antigen | NRK1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179662
|
Novus Biologicals
NBP179662 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
NRK1 Polyclonal specifically detects NRK1 in Human samples. It is validated for Western Blot.Specifications
| NRK1 | |
| Polyclonal | |
| Rabbit | |
| NP_060351 | |
| 54981 | |
| Synthetic peptide directed towards the N terminal of human C9orf95The immunogen for this antibody is C9orf95. Peptide sequence QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bA235O14.2, chromosome 9 open reading frame 95, EC 2.7.1.22, EC 2.7.1.n4, FLJ20559, nicotinamide riboside kinase 1, Nicotinic acid riboside kinase 1, NmR-K 1, NRK 1, NRK1, Ribosylnicotinamide kinase 1, Ribosylnicotinic acid kinase 1, RNK 1 | |
| NMRK1 | |
| IgG | |
| 23 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title