NRK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179662

Catalog No. NBP179662

Description

NRK1 Polyclonal specifically detects NRK1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NRK1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA235O14.2, chromosome 9 open reading frame 95, EC 2.7.1.22, EC 2.7.1.n4, FLJ20559, nicotinamide riboside kinase 1, Nicotinic acid riboside kinase 1, NmR-K 1, NRK 1, NRK1, Ribosylnicotinamide kinase 1, Ribosylnicotinic acid kinase 1, RNK 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence:; Dog: 79%; Mouse: 79%; Zebrafish: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_060351
• Gene Symbols: NMRK1
• Immunogen: Synthetic peptide directed towards the N terminal of human C9orf95The immunogen for this antibody is C9orf95. Peptide sequence QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54981
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.