Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NRSN2 Antibody, Novus Biologicals™

NRSN2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1598320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1598320 20 μL
NBP159831 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1598320 Supplier Novus Biologicals Supplier No. NBP15983120UL

Description

Rabbit Polyclonal Antibody

NRSN2 Polyclonal specifically detects NRSN2 in Human samples. It is validated for Western Blot.

Specifications

Antigen NRSN2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9GZP1
Gene Alias C20orf98, chromosome 20 open reading frame 98, dJ1103G7.6, FLJ23329, neurensin 2, neurensin-2
Gene Symbols NRSN2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NRSN2(neurensin 2) The peptide sequence was selected from the middle region of NRSN2. Peptide sequence LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT.
Molecular Weight of Antigen 22 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 80023
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.