NSF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157536

Catalog No. NBP157536

Description

NSF Polyclonal specifically detects NSF in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: NSF
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: NSF
• Immunogen: Synthetic peptides corresponding to NSF(N-ethylmaleimide-sensitive factor) The peptide sequence was selected from the C terminal of NSF. Peptide sequence STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Canine: 92%; Bovine: 85%; Chicken: 85%; Zebrafish: 85%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Alias: EC 3.6.4.6, NEM-sensitive fusion protein, N-ethylmaleimide-sensitive factor, N-ethylmaleimide-sensitive factor-like protein, N-ethylmaleimide-sensitive fusion protein, SKD2, vesicle-fusing ATPase, Vesicular-fusion protein NSF
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4905
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.