Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NSF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NSF |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
NSF Polyclonal specifically detects NSF in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
NSF | |
Unconjugated | |
RUO | |
4905 | |
Synthetic peptides corresponding to NSF(N-ethylmaleimide-sensitive factor) The peptide sequence was selected from the C terminal of NSF. Peptide sequence STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL. | |
Primary |
Polyclonal | |
Rabbit | |
EC 3.6.4.6, NEM-sensitive fusion protein, N-ethylmaleimide-sensitive factor, N-ethylmaleimide-sensitive factor-like protein, N-ethylmaleimide-sensitive fusion protein, SKD2, vesicle-fusing ATPase, Vesicular-fusion protein NSF | |
NSF | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title