nSMase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159937

Catalog No. NBP159937

Description

nSMase Polyclonal specifically detects nSMase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: nSMase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.4.12, ISC1, lyso-PAF-PLC, Lyso-platelet-activating factor-phospholipase C, Neutral sphingomyelinase, N-SMase, NSMASE, NSMASE1, sphingomyelin phosphodiesterase 2, sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Equine: 85%; Bovine: 78%; Pig: 78%; Mouse: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O60906
• Gene Symbols: SMPD2
• Immunogen: Synthetic peptides corresponding to SMPD2(sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)) The peptide sequence was selected from the N terminal of SMPD2. Peptide sequence RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 6610
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG