nSMase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15993720UL

Catalog No. NBP15993720

Description

nSMase Polyclonal specifically detects nSMase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: nSMase
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: O60906
• Gene Symbols: SMPD2
• Immunogen: Synthetic peptides corresponding to SMPD2(sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)) The peptide sequence was selected from the N terminal of SMPD2. Peptide sequence RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQ
• Quantity: 20 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 6610
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.4.12, ISC1, lyso-PAF-PLC, Lyso-platelet-activating factor-phospholipase C, Neutral sphingomyelinase, nSMase, N-SMase, NSMASE1, sphingomyelin phosphodiesterase 2, sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified