NSUN2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP153052	100 μL

Catalog No. NBP153052 Supplier Novus Biologicals Supplier No. NBP153052

Description

Rabbit Polyclonal Antibody

NSUN2 Polyclonal specifically detects NSUN2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NSUN2
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q08J23
• Gene Alias: EC 2.1.1, EC 2.1.1.29, FLJ20303,5-methycytoisine methyltransferase, hTrm4, member 2, Myc-induced SUN-domain-containing protein, NOL1/NOP2/Sun domain family 2, NOL1/NOP2/Sun domain family member 2, NOP2/Sun domain family, member 2, SAKIMisu, Substrate of AIM1/Aurora kinase B, TRM4MISU, tRNA (cytosine-5-)-methyltransferase, tRNA (cytosine-5-)-methyltransferase NSUN2, tRNA methyltransferase 4 homolog
• Gene Symbols: NSUN2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to NSUN2(NOL1/NOP2/Sun domain family, member 2) The peptide sequence was selected from the C terminal of NSUN2. Peptide sequence FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54888
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Chicken: 78%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only