NT5C1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24860425UL

Catalog No. NB396083

Description

NT5C1A Polyclonal antibody specifically detects NT5C1A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NT5C1A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 5'-nucleotidase, cytosolic IA, AMP-specific 5'-NT, CN1, cN1A, CN-I, cN-IA, cytosolic 5' nucleotidase, type 1A, cytosolic 5'-nucleotidase 1A, Cytosolic 5'-nucleotidase IA, EC 3.1.3.5, MGC119199, MGC119201
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGP
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 84618
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified